PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G219600.1.p
Common NameGLYMA_10G219600, SNAC38
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 561aa    MW: 62759.9 Da    PI: 4.4481
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G219600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-53201462128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                          +pGfrFhPtdeelv++yLk+k+ gk+l+l +vi+e+d+yk++P+dLp +  +k+++++w+fF++rd+ky++g r+nrat++gyWkatgkd
  Glyma.10G219600.1.p  20 MPGFRFHPTDEELVMYYLKRKICGKRLKL-DVIRETDVYKWDPEDLPgQsILKTGDRQWFFFCHRDRKYPNGGRSNRATRRGYWKATGKD 108
                          69***************************.99**************96446788999********************************* PP

                  NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++v++ +++ vg+kktLvfy grap+ge+tdWvmhey+l
  Glyma.10G219600.1.p 109 RNVIC-NSRSVGVKKTLVFYAGRAPSGERTDWVMHEYTL 146
                          *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6015169IPR003441NAC domain
PROSITE profilePS5100554.21919169IPR003441NAC domain
PfamPF023654.9E-2821146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGEASGAGSA DCFSQMMSSM PGFRFHPTDE ELVMYYLKRK ICGKRLKLDV IRETDVYKWD  60
PEDLPGQSIL KTGDRQWFFF CHRDRKYPNG GRSNRATRRG YWKATGKDRN VICNSRSVGV  120
KKTLVFYAGR APSGERTDWV MHEYTLDEEE LKRCLGVKDY YALYKVYKKS GPGPKNGEQY  180
GAPFNEEQWA DDDIVDFNIN SADQEAPNDV DNGNVLQPLL DDEIDNIIRG ILDDELVLDQ  240
QHVNGYPDFP QVVSEETQST VVDQFSEAVM FPEPVRITQP SNQFFDAQPS FDFNQPVTSH  300
LHVSEASEVT SASSIKAKEL DFNEDGFLEI NDLIDTEPIL ANMENPVEYQ QFEDGLSELD  360
LFQDAQMFLR DLGPIIHETD SHAYTNAFVS SNIESQSYQL LPNPEDANQT VGEFWMHGER  420
NTPSASEGFV DSFSLSSPGV VYESVGFPTE GNNNQSSTVE DVATSSFSSA LWAFVESIPT  480
TPASAAESAL VNRALNRMSS FSRLKIKHTN IAAAGKDTAT MKRAGRKGLP FLFFPIIIAL  540
CAFCWVFVGN LRLLGRCVSP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-492114617140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13746KRKICGKRLK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.502990.0cotyledon| flower| leaf| pod| root| somatic embryo| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6573050.0KF657305.1 Glycine max NAC transcription factor (SNAC38) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274375.10.0uncharacterized protein LOC100794925
TrEMBLI1LDA80.0I1LDA8_SOYBN; NAC transcription factor
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Representative plantOGRP9932711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-133NAC domain containing protein 17